SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357068 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357068
Domain Number 1 Region: 156-340
Classification Level Classification E-value
Superfamily E set domains 1.82e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000105
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1e-18
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357068
Sequence length 379
Comment KCNJ10 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 10
Sequence
MTSVAKVYYSQTTQTESRPIMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVAPPSGLRDSTVRYGDPEKLKLEKS
LREQAEKEGSALSVRISNV
Download sequence
Identical sequences G5BWL2
XP_004858793.1.39548 XP_004858794.1.39548 HGL_H00000357068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]