SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357202-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357202-1
Domain Number 1 Region: 173-335
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-33
Family DnaQ-like 3'-5' exonuclease 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357202-1
Sequence length 347
Comment ISG20L2 (Homo_sapiens) interferon stimulated exonuclease gene 20kDa-like 2
Sequence
MSALLLNLDFAECPPKKSLEGNAKHRNFVRRRRFLEQRGFLNKKNQRPSKVPKPHSEPTK
KGETPRVDGTGKIHPPQRKKTAASSDGSEQSLDQKAAVSWLTPAPSKKTDSAVGKVDLLG
EFQSDLPKIKSPPARSQKKPLQKKPPQKSAAQNAPQAHSDSVRSGASQKPGKMVAIDCEM
VGTGPKGHVSSLARCSIINYDGDVLYDEYVLPPCPIVDYRTRWSGIRKHHMLKATPFKTA
RSQILKILSGKVVVGHAIHNDFKALQYFHPKPLTRDTSQIPLLNRKASCPENATMSLKTL
TKKLLGWDIQAGKSGHSSVEDAQATMELYKLVEVEWEHHLAQNPPKN
Download sequence
Identical sequences G5AR80
HGL_H00000357202-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]