SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357336 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357336
Domain Number 1 Region: 1256-1309
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000564
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357336
Sequence length 1312
Comment RUSC1 (Homo_sapiens) RUN and SH3 domain containing 1
Sequence
MPESGRGRLVPPTGGEATGGAWAATDRDVRPRVRPARRPRGAAARPAALPGAPPSALDPA
VGDPGANSRPRPPSGSGGPGEDSAARGCSGRGREAGKALGKGWAVADDGDRRRTDRRLSQ
GSASAWPGGWMREAQSCWFSRGHRVAAGTMLSPQRALLCNLNHIHLQHVSLGLHLSRRPE
LREGPLSASPPPGDTGGKESSGPCGGTLVDANSNSPAVPCRCCQEHGPTQNQPGPTQEEH
GVASPSDPGCSSSLSSCSDLSPDESPVSVYSRHRPGEEDAHYQPSVVPLEQGFPLALAVP
GTCSPDSFCCSPDSCSGASSPPGPGLDSNCNALTAGQGLPSPGLEEEDDGGEQDLPASEL
SEEEDGKIGAGRTEPSWKINPIWKIDTEKTEAAWKITENNNCGWKISGNTDSGWKTEPGE
CHGWNSNTGTADSGSKTDAGKAAGGRRSDVVEEPAPHRTVTSFHELAQKRKRGPGLPLVP
QAKKDRSDWLIVFSPDSELPPGGSLSGSSVPPREVTTFKELRSRSRAPPPAVPPRDXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXRRSRVPQGPGAAPERHRRPRQPPASLRSKVAASFSPHPVRSSWSFAGVPGAQRLW
MAEAQGGAGQLQEQKKGLLSVLYLPTGFFSLAWGGCPSLSTELLLLLQPLSVLTFHLDLL
FEHHHHLPLGPPQAPAPQVPPPALQQTVQAVLHWGGRLAQSLRGAAPAPSAPSSPTSGSW
WEQLSQASQVYASGGSEGFPLLRWGPRRHGTAAESAQERPLAAEEAAPGRGAWLGRLFGV
PGGPTENESGGQKSRRPSSWLPPAVSVLALVKRVPPHETPSPKELEASAPGAAQAHRAVR
ALCDHTAAGPDQLSFQRGEVLRVVGTMGEDWLRCGRDGAEGLVPVGYTSLVL
Download sequence
Identical sequences HGL_H00000357336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]