SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357342 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357342
Domain Number 1 Region: 403-594
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.99e-50
Family cAMP-binding domain 0.0000000286
Further Details:      
 
Domain Number 2 Region: 142-406
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.07e-37
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357342
Sequence length 802
Comment HCN3 (Homo_sapiens) hyperpolarization activated cyclic nucleotide-gated potassium channel 3
Sequence
MAAALRPESRHPRGDEVRLHTPNPGPWALPPRSRAPLQSRPPRLRPRPRNPLGATRTAPA
RGPIPARSPAPASPLRRRRREGARTHALPSLPPGSRPARTYSASRAPSPPAVPSDTSRGP
VPEPGASAPSFSCVTRWACDRLFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNV
LSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDFISSIPVDYIFLVVE
LEPRLDTEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRI
FNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVYMNRMVNHSWGRQYSHALFKAMSHMLC
IGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYM
SFHKLPADTRQRIHEYYEHRYQGKMFNEESILGELSEPLREEIINFTCRGLVAHMPLFAH
ADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGVRDTRLTDGSYF
GEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLRRIGKKN
SILQRKRSEPSPSPSPSPSPGSGGGTMEQRLVQHDRDMARGVRGLGPGPGARLAGRPVLW
EPLVHAPLQAAAVTSNVAIALTHHRGPLPLSPDSPAALLARSARRAAGSPASPLVPIRAG
PLLAQGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGAGNRRWLSSAEGLRKRA
PALLGAPAQASRDSTATQATSA
Download sequence
Identical sequences G5BDF9
HGL_H00000357342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]