SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357513-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357513-5
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily Tropomyosin 4e-102
Family Tropomyosin 0.000000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357513-5
Sequence length 285
Comment TPM3 (Homo_sapiens) tropomyosin 3
Sequence
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM
Download sequence
Identical sequences A0A2K6EQP5 D2HJP4 E2RBW4 G5BDC1
10141.ENSCPOP00000006558 HGL_H00000357513-5 XP_001496180.2.31192 XP_003475610.1.53824 XP_004619306.1.94378 XP_004871432.1.39548 XP_005411524.1.28644 XP_005622301.1.84170 XP_005867519.1.60319 XP_006159853.1.99106 XP_006861550.1.41390 XP_007087999.2.5354 XP_008153980.1.99482 XP_008525116.1.77740 XP_010642254.1.5607 XP_011289555.1.62641 XP_012514036.1.63892 XP_014720406.1.49734 XP_016076946.1.3490 XP_019286778.1.44245 XP_019658617.1.58354 XP_021537863.1.83697 ENSCAFP00000025527 ENSCPOP00000006558 ENSCPOP00000016776 ENSCAFP00000025531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]