SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357513-6 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357513-6
Domain Number 1 Region: 7-145
Classification Level Classification E-value
Superfamily Tropomyosin 2.13e-38
Family Tropomyosin 0.00000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357513-6
Sequence length 145
Comment TPM3 (Homo_sapiens) tropomyosin 3
Sequence
MAGITTIEVVKRKIQVLQQQANDAEEKAGCLQQEVEGERQARGQAEAEVASLTRRIQLVE
EELDHAWERLATALQKLEEAEKAANESERGMKVIENWALKDEEKMKLQEIQLKEAKHIAG
EADRKYEEVALKLVIIEGDLKCTEE
Download sequence
Identical sequences G5C243
HGL_H00000357513-6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]