SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357656-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357656-1
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-83
Family Protein kinases, catalytic subunit 0.000000000656
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-28
Family SH3-domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357656-1
Sequence length 537
Comment FYN (Homo_sapiens) FYN oncogene related to SRC, FGR, YES
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences A0A250Y2G0 A0A286XJ68 A0A2K5F9P6 A0A2K5QZE7 A0A2K6F3I9 A0A2K6UHS9 D2H640 E2RC09 F7IB43 G1P913 G5AUN8 I3M9M0 K9IL43 M3X148
HGL_H00000357656-1 ENSSTOP00000006598 ENSCPOP00000011542 ENSCJAP00000009029 ENSCPOP00000011542 ENSAMEP00000017665 ENSMLUP00000006692 10141.ENSCPOP00000011542 9615.ENSCAFP00000005934 XP_002747081.1.60252 XP_002917202.1.58354 XP_003466546.1.53824 XP_003781644.1.62490 XP_003986517.1.62641 XP_004422281.1.5094 XP_004605783.1.94378 XP_004874671.1.39548 XP_004874672.1.39548 XP_005337476.1.77405 XP_005627774.1.84170 XP_005883794.1.60319 XP_005883796.1.60319 XP_005883797.1.60319 XP_005883798.1.60319 XP_006084426.1.53796 XP_006084427.1.53796 XP_006084428.1.53796 XP_006760230.1.95426 XP_006760232.1.95426 XP_006760233.1.95426 XP_006839984.1.41390 XP_006879093.1.29581 XP_007078783.1.5354 XP_007078784.1.5354 XP_007109945.1.24612 XP_007190775.1.59432 XP_007190776.1.59432 XP_007452658.1.90284 XP_008157603.1.99482 XP_008513014.1.77740 XP_008513015.1.77740 XP_008513016.1.77740 XP_008513017.1.77740 XP_008513018.1.77740 XP_008513019.1.77740 XP_008578889.1.73410 XP_008704431.1.72690 XP_008704432.1.72690 XP_008850620.1.79516 XP_010344784.1.74449 XP_010629141.1.5607 XP_010629142.1.5607 XP_010963734.1.22495 XP_010963735.1.22495 XP_010963736.1.22495 XP_010990304.1.51371 XP_011220550.1.58354 XP_012293833.1.9421 XP_012293835.1.9421 XP_012395009.1.21590 XP_012395010.1.21590 XP_012395011.1.21590 XP_012498291.1.63892 XP_012608559.1.48125 XP_012608560.1.48125 XP_012608561.1.48125 XP_012608562.1.48125 XP_012608563.1.48125 XP_012608564.1.48125 XP_012924642.1.39548 XP_013004450.1.53824 XP_014307289.1.53796 XP_014307290.1.53796 XP_014386830.1.60319 XP_014386831.1.60319 XP_014417009.1.101512 XP_014417010.1.101512 XP_014417012.1.101512 XP_014636657.1.5094 XP_014636658.1.5094 XP_014636659.1.5094 XP_014721656.1.49734 XP_014721657.1.49734 XP_014721658.1.49734 XP_014721659.1.49734 XP_014721660.1.49734 XP_014721661.1.49734 XP_014920856.1.86478 XP_014920857.1.86478 XP_014920858.1.86478 XP_015095929.1.17985 XP_015095930.1.17985 XP_015095931.1.17985 XP_015355803.1.40921 XP_015391513.1.5354 XP_015417110.1.95426 XP_016072978.1.3490 XP_016072979.1.3490 XP_017364739.1.71028 XP_017364740.1.71028 XP_017364741.1.71028 XP_017364742.1.71028 XP_017364743.1.71028 XP_017826815.1.60252 XP_017826816.1.60252 XP_017826817.1.60252 XP_019298659.1.44245 XP_019298660.1.44245 XP_019298661.1.44245 XP_019298662.1.44245 XP_019298663.1.44245 XP_019298664.1.44245 XP_019298665.1.44245 XP_019652981.1.58354 XP_019686651.1.62641 XP_019686652.1.62641 XP_019686653.1.62641 XP_019686654.1.62641 XP_019686655.1.62641 XP_019785150.1.83887 XP_019785151.1.83887 XP_020033406.1.5219 XP_020033408.1.5219 XP_021526158.1.9421 XP_021526159.1.9421 XP_854467.1.84170 ENSMLUP00000006692 ENSCJAP00000008994 ENSTTRP00000013794 ENSCAFP00000005934 ENSCAFP00000005934 ENSAMEP00000017665 ENSFCAP00000020340 ENSSTOP00000006598 ENSTTRP00000013794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]