SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357819 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357819
Domain Number 1 Region: 258-350
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-24
Family Tudor domain 0.0000058
Further Details:      
 
Domain Number 2 Region: 59-122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357819
Sequence length 487
Comment TDRKH (Homo_sapiens) tudor and KH domain containing
Sequence
MEKDVRGQWKMSTEQTSWTSLSTLQKVALGLGIPASAAVAYILYRRYRESREERLTFVGD
NDIEIEMRVPQEAVKLIIGRQGANIKQTGARIDVDTEDVGEECVLLISGFPVQHLILEKV
SEDEELRKRIAHSAEARVPRKQPISVRREETESGGAGEPALWENASSGSGGRQAAALAVP
ARKGGGDPTVVRPKEGSWEEADHGFQESGAQASPEKSIFEIPSPDFSFHADEYLEVYVSA
SEHPNHFWIQIVGSRSLQLDKLVSEMTQHYENSPPEDLTARVGDIVAAPLSANGSWYRAR
ILGTLENGNLDLYFVDFGDNGDCPLRDLRALRSDFLSLPFQAIECSLARIAPSGEQWEEE
ALDEFDRLTYCADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKLDIGLELVRKGYAIE
LPEDVEENRAVPDMLKDMATETDASLASMLTEPRKSPGELAHTLSCLSLSEAASMSGDDN
LEDDYLL
Download sequence
Identical sequences G5B8L0
HGL_H00000357819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]