SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357904 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357904
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000128
Family LysM domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357904
Sequence length 227
Comment LYSMD1 (Homo_sapiens) LysM, putative peptidoglycan-binding, domain containing 1
Sequence
MASPSRQPPLGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLKPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVSPSKGDSWPHS
AESSKQEPGSERTKGDILPTPGQDSPGPTHDLSASDFLKKLDSQISLSKKVAAQKLSKGE
SGVPGKDPRFHLSSPRMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences G5AJZ3
XP_004854076.1.39548 HGL_H00000357904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]