SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357906 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000357906
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0536
Family Molybdopterin synthase subunit MoaE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357906
Sequence length 184
Comment TNFAIP8L2 (Homo_sapiens) tumor necrosis factor, alpha-induced protein 8-like 2
Sequence
MESFSSKSLALQVEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKDYTHSRPQAQRVI
KDLVKVAVKVAVLHRNGCFGPEELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVGRHLTPKSHGRIRHVFDHFSDLGLLTALYGPDFRQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences G5AJZ2
XP_004854074.1.39548 XP_004854075.1.39548 HGL_H00000357906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]