SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358089 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358089
Domain Number 1 Region: 7-194
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.19e-47
Family Canonical RBD 0.0000247
Further Details:      
 
Domain Number 2 Region: 213-297
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.3e-23
Family Canonical RBD 0.00000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358089
Sequence length 392
Comment TIAL1 (Homo_sapiens) TIA1 cytotoxic granule-associated RNA binding protein-like 1
Sequence
MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQ
HTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGD
LSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWL
GGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQ
TFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTK
NFQQVDYSQWGQWGQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQPPSAAWMG
GFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
Download sequence
Identical sequences G5BVW9
HGL_H00000358089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]