SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358210 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358210
Domain Number 1 Region: 218-322
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.34e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-165
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000128
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 5-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358210
Sequence length 754
Comment SIM1 (Homo_sapiens) single-minded homolog 1 (Drosophila)
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVCLDMSPFDGCYQTVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDMKLIFLDSRVAEL
TGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAKHGGWVWVQSYAT
IVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYASSSTPTLTDNRKGSK
SRLSSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPAERPGLQHDA
SCAYRQFSDRSSLCYGFALDHSRLVEDRHFHSQACEGGRCEAGRYFLGAPQAGREPWWGS
RAALPLTKASPESREAYENSMPHIASVHRTHGRSHWDEDSVVSSPDPGSASESGDRYRTE
QYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKGPPDQLASINGAGKKHSLCFANYSQP
PPTGEVCHSSALANTSPCDHIQQREGKMLSPHDNDYDNSPTALSRISSPNSDRISKSSLI
LAKDYLHSDMSPHQTAGDHAAVSPNCFGSHRQYFDKHAYTLTGYALEHLYDSETIRNYSL
GCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
Download sequence
Identical sequences G5BH57
HGL_H00000358210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]