SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358262 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358262
Domain Number 1 Region: 234-503
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-58
Family Tandem AAA-ATPase domain 0.00018
Further Details:      
 
Domain Number 2 Region: 11-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-54
Family Tandem AAA-ATPase domain 0.0000313
Further Details:      
 
Domain Number 3 Region: 682-839
Classification Level Classification E-value
Superfamily Macro domain-like 2.2e-29
Family Macro domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358262
Sequence length 862
Comment CHD1L (Homo_sapiens) chromodomain helicase DNA binding protein 1-like
Sequence
MFTLCICFFFLFLGIHLRPYQLEGVNWLVECFHCRNGCILGDEMGLGKTCQTIALFIYLE
GRLNDEGPFLILCPLSVLSNWKEEMERCAPGLSCVTYAGDKEERVHLQQVLTQDSHFHVL
LTTYEICLRDASFLKSFSWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNS
LQELYSLLSFVEPDLFSKEQVEDFVQRYQDIEKESKSGNELHRLLQPFLLRRVKAEVATE
LPKKTEVVIYHGMSALQKKYYKAILMKDLDAFENEMAKKVKLQNILSQLRKCVDHPYLFD
GVEPEPFEVGDHLIEASGKLHLLDKLGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGS
VRGEERHLAIKNFGQQPIFVFLLSTRAGGVGMNLTAADTVIFIDSDFNPQNDLQAAARAH
RIGQNKPVRVIRLIGRDTVEETVCRRAASKLQLASVAVGGGHCALGARQPLGDADLQLSE
ILKFGLDKLLSSEGSTMDEIDLESILGETKAGQWASDALPAAGEGSGEQEEGKNHMYIFE
GKDYSKEPSKEDRRSFEQLVNLQKTLLEKTSQGGRSLRNKGSVLVPGLVEGSSKRKRILS
PGELEDRWKKRQEAAAKRKRLVEEKKREKEEVEHKKKMAWWESNNYQSFCLPSEESEPQD
LDGGKEESAAELNYEDHDSASIQYVSGDVTHPQAGEEDAFIVHCVDDSGRWGRGGLFTAL
ETRSAEPRKIYELAGKMKDLSLGAVLLFPIDDKESRNKGQDLLALIVAQHRDCANVLSGI
KMTALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYF
PRNKGSISHSKSPSSSSTQLVP
Download sequence
Identical sequences G5BA07
HGL_H00000358262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]