SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358293 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000358293
Domain Number - Region: 288-399
Classification Level Classification E-value
Superfamily Tropomyosin 0.00347
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358293
Sequence length 897
Comment C10orf118 (Homo_sapiens) Uncharacterized protein C10orf118 (CTCL tumor antigen HD-CL-01/L14-2)
Sequence
MSETEHIASIPSEKHIGKTPELKEDSCNSFSGDESSKLENESKLLSLNFDKILCQPNEHC
QIEASENYVPDHGGGEDSCAKIDTCPENSEQIANFPSGDSAKQVSKTSETEQTVTQILAE
LRSSTFTEAANQKTYSESPYDTDCTKKLISKIKTVSASEDLLEQIESELLSTEFAEHQVP
NGMNKGEHALVLFEKCVQDKYLQQEHTIKKLIKENKKHQELILDICSEKDNLREELKKRT
ETEKQHMSTIKQLETRIEELNKEVKASKDKLVAQDVAAKNTIQQLHKEMAQRMEQANKKC
EEARQEKEAMVMKYVRGEKESLDLRKEKEILERKLRDANKEFEKNTNKIKQLSQEKGRLQ
QLYETKESETTRLIREIDKLKEDINSHIIKVKWAQNKLKAEMDLHKETKDKLKETTTKLT
QAKEEADQIRQNCQDMIKTYQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLEMHHAKI
KELEDLKRTFKEGMDELRTLRTKAKCLEDERLRTEDELSKYKEIINRQKAEIQNLLDKVK
ITDQIQEQLQRGKQEIENLKEEVESLNSLINDLQKDIEGSRRRESELLLFTEKLTSKNAQ
LQSESNSLQSQLDNLSCSESQLQSQCEQMKQTNINLESRLLKEEELRKEEVQTLQTELTC
RQTEVKALSVQVEELKDELVTQRRKQASNIKDLTKQLQQARRKLDQVENGSYDKEVSSMG
SRSSSSGSLNARSSAEDRSPENTGSSVAVDSFPEVDKAMLIERIVRLQKAHARKNEKIEF
MEDHIKQLVEEIRKKTKIIQSYILREESGTLSSEASDFNKVHLSRRGGIMASLYTSHPAD
SGLTLELSLEINRKLQAVLEDTLLKNITLKENLQTLGTEIERLIKHQHELEQRTKKT
Download sequence
Identical sequences G5BKA5
HGL_H00000358293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]