SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358413 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358413
Domain Number 1 Region: 344-400
Classification Level Classification E-value
Superfamily SH3-domain 0.000076
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358413
Sequence length 413
Comment ZDHHC6 (Homo_sapiens) zinc finger, DHHC-type containing 6
Sequence
MNTLCSVIKFENLQELKRLCHWGPIVALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIM
LINWTVMILYNYFNAMFVGPGFVPLGWKPEDSQDGMYLQYCKACQAYKAPRSHHCRKCNR
CVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYNRLSFGWNT
VKIDMSAARRDPLPVVPFGLAAFAATLFALGLAVGTTIAVGMLFFIQMKIILRNKTSIES
WIEEKAKDRIQYYQLDEVFVFPYDMESRWKNFRQVFTWSGVPAGDGLEWPVKEGCQQYSL
TIEQLKQKADKRVRSVRYKAIEDYNGACCPLNRGIKTFFTSPCTEEPRIQIRKGEFILAT
RGLRYWLYGDKILDDSFVEGLSRIRGWFPRNCVEKCPCDTETDPTPEGEKKNR
Download sequence
Identical sequences G5BKD2
HGL_H00000358413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]