SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358451 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358451
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Macro domain-like 2.19e-36
Family Macro domain 0.00045
Further Details:      
 
Domain Number 2 Region: 239-380
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000157
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358451
Sequence length 442
Comment GDAP2 (Homo_sapiens) ganglioside induced differentiation associated protein 2
Sequence
MLAGPDLKEDLQKLKGCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYR
NVLQLAKEQSVSSVGFCVINSAKRGYPLEDATHIALRTVRRFLEIHGHTIEKVVFAVSEL
EEATYQKLLPLYFPRSLKEETLSLPYLPADIGNAEGEPVVPERQIRISEKPGAPEDNQEE
EDEGLRDDLSFIGSHAFARMEGDIDKQRKLILQGQLSEAALQKQHQRNYNRWLCQARSED
LSDIASLKALYQTGVDNCGRTVMVVVGRNIPVTLIDMDKALLYFIHVMDHIAVKEYVLVY
FHTLTSEYNHLDSDFLKKLYDVVDVKYKRNLKAVYFVHPTFRSKVSTWFFTTFSVSGLKD
KIHHVDSLHQLFSAISPEQIDFPPFVLEYDARDVDFIVSGERAARENSHCYAPVRKMNDG
EGWTDESPSEARGKMELELGQW
Download sequence
Identical sequences G5B2R6
HGL_H00000358451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]