SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358479 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358479
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.3e-17
Family Canonical RBD 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358479
Sequence length 246
Comment SRSF12 (Homo_sapiens) serine/arginine-rich splicing factor 12
Sequence
RPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQYPLFFIFEDVRDAEDALYNLNRKW
VCGRQIEIQFAQGDRKTPGQMKSKERHPCSPADHRRSRSPSQRRTRSRSSSWGRNRRCSD
SFKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNSGSRGRSRSKSLQKRSKSIGKS
QSNSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKAQTAKHSHFRSHSRSRSY
RHKNSW
Download sequence
Identical sequences G5AZM1
HGL_H00000358479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]