SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358532 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358532
Domain Number 1 Region: 451-532
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-17
Family Canonical RBD 0.00044
Further Details:      
 
Weak hits

Sequence:  HGL_H00000358532
Domain Number - Region: 347-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000466
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 1097-1133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00298
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358532
Sequence length 1165
Comment RBM20 (Homo_sapiens) RNA binding motif protein 20
Sequence
SAAKLLDKTLFSVCNPNPLLPSPASLQLAQLQAQLTLHRLKLAQTAVTSNTAAATVLNQV
LSKVAMSQPLFNQLRHPAVLGTPHGPAAVPQHPVTMASARFPSNATAFSPPSQTRGPGPS
VSLPSQPPSAIVVHPFGGVMSQTPAQPAVILGIGKAGPGAATTGFYECSQTNPGQASGSE
ADGQPGFLPASGSTSGSVTYEGHFSHTGQDGQAAFSKDFYSPSAQGSNVVAGFPAEQAGA
MKSEMGPLLQGTNSQWESPAGFSGQGKADLAAAPNLWPPPPGQHYELYNPEEPTADRTPP
SFGARLNNSKQGFGSARRAKEEKAMRCLRPLQPRELDDFRGVTPVRLPHVCSMCDKEVFD
LKDWELHVKGKLHAQKCLVFSENAGIRCVLSSADGTLCASPNNAAVYNPAGSEDYASDLG
TSFAANPARSFAPSNPAFPSAASGTSFAQRKGAGRVVHICNLPEGSCTENDVINLGLPFG
KVTNYILMKSTNQAFLEMAYTEAAQAMVQFYQEKSAVINGEKLLIRMSKRYQELQLKKPG
KTVAAIIQDIHSQRERDMFREVDRYGPERPRSRSPMSRSLSPRSHAPSFTSCSSSHSPPG
PSRADWGNGRDSWEHSPYAWREEERDPVSWRENGDEKRDRTDTWPLDRQHYPRPLDKAEL
DERLEGGRGHREKYLRSGPPSPLHSVSSYKCREDGYYRKEPKTKLEKYLKQQDVPGRSRR
KEEARLRESRHPHPSDSGKEDGLGPKVTRTPEGTKSKQSEKNKTKRPDRDQEGADDRKES
KVAENEAAKEEQEGMEESPQSVGRQEKETESSDPKTARAKKEQDWESGSEAEGDSWYPTN
MEELVTVDEVGEDEDFIMEPDIPELEDILPIDQKDKICPEICPCVTTTLDLQVATDLDFI
NEGVKTIENGPAEIGCKLPRQLPSASTSCSSDMNVDAPGPNLDAERKPAECETGLSLEDS
DCYEKEAKRTESSDVCLAPAAQQMSSLQPAEERAQQPSPFPDDCKAKGTPEDGASEGSPQ
EEKASPPTETDLQSQACQGVVTEENSRYMEMKPLDVRSPEYTKVELREPLSLPSWEPEDV
FSELSIPLGVEFVVPRTGFYCKLCGLFYTSEEAAKVSHCRSAVHYRNLQKYLSQLAREDV
KGTAGAGSPRPEDSGMVPRFERKKL
Download sequence
Identical sequences G5BKC2
HGL_H00000358532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]