SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358558 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358558
Domain Number 1 Region: 248-383
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.62e-41
Family Synaptotagmin-like (S variant) 0.00000575
Further Details:      
 
Domain Number 2 Region: 109-239
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.96e-39
Family Synaptotagmin-like (S variant) 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358558
Sequence length 456
Comment SYT6 (Homo_sapiens) synaptotagmin VI
Sequence
MADKLKDPSTLGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTS
FKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGDDAKSEGAKSCGKIN
FSLRYDYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTF
DENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQY
ATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKK
KKTTIKKNTLNPIYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGIHAEGL
GRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEVGEIAWALACLLHDGVGWRMAVGCCKSLG
LLWEGSQGPHASQQVCNRQEWEEDGGCLTKSPCLEF
Download sequence
Identical sequences G5ATE2
HGL_H00000358558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]