SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358635-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358635-1
Domain Number 1 Region: 330-433
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.07e-23
Family Canonical RBD 0.00041
Further Details:      
 
Domain Number 2 Region: 146-240
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-22
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 3 Region: 244-330
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-17
Family Canonical RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358635-1
Sequence length 623
Comment SYNCRIP (Homo_sapiens) synaptotagmin binding, cytoplasmic RNA interacting protein
Sequence
MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDER
AIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPD
EAKIKALLERTGYTLDVTTGQRKYGGPPPDSIYSGQQPSVGTEIFVGKIPRDLFEDELVP
LFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISV
ANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAA
QARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQ
FGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGG
YEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARG
GAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDH
SGNYGYKSENQEFYQDTFGQQWK
Download sequence
Identical sequences G5B6Z5
XP_007949258.1.48129 XP_012667854.1.62490 XP_012667857.1.62490 HGL_H00000358635-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]