SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358696 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358696
Domain Number 1 Region: 207-577
Classification Level Classification E-value
Superfamily Sema domain 5.62e-90
Family Sema domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1412-1529,1724-1912
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.94e-42
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 41-204
Classification Level Classification E-value
Superfamily Sema domain 2.62e-41
Family Sema domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1103-1208
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000296
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 5 Region: 921-1018
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000312
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 6 Region: 1016-1105
Classification Level Classification E-value
Superfamily E set domains 0.000000000000937
Family Other IPT/TIG domains 0.043
Further Details:      
 
Domain Number 7 Region: 580-630
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000227
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 1206-1285
Classification Level Classification E-value
Superfamily E set domains 0.00000327
Family Other IPT/TIG domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358696
Sequence length 1943
Comment PLXNA3 (Homo_sapiens) plexin A3
Sequence
MLVGLSTVAAGHAPSVPCLASSSPSGQGSRWWQALPCLCGLTHLAVHRVTGDVFVGAVNR
VFKLAPNLTELRAHVTGPVEDNARCYPPPSMRVCAHRLVPVDNVNKLLLIDYAAHRLVAC
GSIWQGICQFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQGQGPSKLFVGTAVD
GKSEYFPTLSSRKLIGNEDSAEMFSLGICQFLRLDDLFKLGEPHHRKEHYLSGAQEPDSM
AGVIVEQGQGPSKLFVGTAVDGKSEYFPTLSSRKLIGNEDSAEMFSLVYQDEFVSSQIKI
PSDTLSLYPAFDIYYIYGFVSASFVYFLTLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSE
FYSYVEFPIGCSWRGVEYRLVQSAHLAKPGLLLAQALGVPADEDVLFTIFSQGQKNRASP
PRQTILCLFTLSNINAHIRHRIQSCYRGEGTLALPWLLNKELPCINTPMQINGNFCGLVL
NQPLGGLHVIEGLPLLADSTDGMASVAAYTYHQHSVVFIGTRSGSLKKVRVDGSQDAHLY
ETVPVVDGSPILRDLLFSPDHRHIYLLSEKQVSQLPVETCEQYPSCVACLGSGDPHCGWC
VLQHRCCREGACPGASTPHGFAEELSKCVQVRVRPNNVSVTSPGVQLTVALRNVPDLSAG
VSCAFGEVTESEAIVLASGELRCSSPSPQELQALIRGHGATRTVRLQLLAKETGVKFAGA
DFVFYNCSVLHSCMSCVGSSYPCHWCKYRHMCTSHPHECSFQEGRVHSPEGCPELLPRGD
LLIPVGVMQSLTLRAKNLPQPQSGQKNYECVIRVQGRQQRVPAVRFNSSSVQCQNASYSY
EGDEYGDTELDLSVVWDGDFPIAKPPSFRALLYKCWAQRPSCGLCLKADPRFNCGWGIQL
RAHCPTPKTNWMHPSQKGTRCSHPRISQIHPLMGPKEGGTRVTIVGENLGLASREVSLRV
AGVRCSSIPTEYVSAERIVCEMEESLVPSPPPGPAELCVGDCSSDFRTQSEQLYSFVTPT
FDRVSPTRGPASGGTRLTISGRSLDAGSSVTVTVRDGECQFVRRGAEAIVCISPVSTLGP
SQAPITLAIDRANISSPGVIYTYTQDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRV
RAKYRGIETTNTCQVINDTAMLCKAPGIFLGQPQPRAQGEHPDEFGFLLDHVQTARSLNR
SSFTYYPDPSFEPLGPSGVLNVKPGSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCALTV
SDTQLLCDSPRQTGRQPVMVLVGGLEFWLGTLHITAERALTLPALVGLAVGGGLLLLAIA
AVLVAYKRKTQDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNHMDGVQIPF
LDYRTYAVRVLFPGIEAHPVLKELDTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSF
SMRDRGTVASLTMVALQSRLDYATGLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKML
TNWFTLLLHKFLKVRWGRAAGGPIDAITGEARYSLSEDKLIRQQIDYRTLTLHCVCPESE
GGSQVPVKVLNCDSVTQAKDKLLDAVYKGIPYSQRPKAEDMDLEWRQGRMARVILQDEDV
TTKIECDWKRVNSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTTSSP
DSLRSRAPMITPDQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKF
VDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNV
IKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWV
ERYYRDIAKMASISDQDMDAYLVEQSRLHASDFNVLSALSELYFYVTKYRQELLTALDRD
ASCRKHKLRQKLELAISLGSSGS
Download sequence
Identical sequences HGL_H00000358696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]