SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358784 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358784
Domain Number 1 Region: 66-91,120-317
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-60
Family Voltage-gated potassium channels 0.0004
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000133
Family Tetramerization domain of potassium channels 0.0000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358784
Sequence length 408
Comment KCNA3 (Homo_sapiens) potassium voltage-gated channel, shaker-related subfamily, member 3
Sequence
MRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMYP
ESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDAFKAPSNSTSGAPAE
ASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTEL
AERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFI
GVILFSSAVYFAEADDPSSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIA
GVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKS
EYMVIEEGGMNHSAFPQTPFKTGNSTAACTTNNNPNSCVNIKKIFTDV
Download sequence
Identical sequences G5BD82
HGL_H00000358784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]