SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358786 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358786
Domain Number 1 Region: 212-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.07e-58
Family Voltage-gated potassium channels 0.00046
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 9.42e-25
Family Tetramerization domain of potassium channels 0.00000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358786
Sequence length 511
Comment KCNA10 (Homo_sapiens) potassium voltage-gated channel, shaker-related subfamily, member 10
Sequence
MDVRGWKEMEVALVNFDNSDEIQEEPGYATDFDPTSRKGRPGSSPFSNWKILISDSTNHE
TAFSKFPGDYANSPGPEPAILNEGNQRVIINIAGLRFETHLRTLNQFPETLLGDREKRIQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNEFHRQFWLLFEYPESSSAARSVAVVSVLVVVISITIFCLETLPE
FREDRELKVGRDPSLNTNMTALSQTMFTDPFFVVESTCIVWFTFELVLRFMVCPSKTDFF
RNIMNIIDVISIIPYFATVITEQVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETESEEKQNIPGEI
DKILNSVGSRMGSTDSLSKTNGGCSTAKSRK
Download sequence
Identical sequences G5BD80
HGL_H00000358786 XP_004853742.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]