SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358789 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358789
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PX domain 5.36e-33
Family PX domain 0.00017
Further Details:      
 
Domain Number 2 Region: 138-197
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-20
Family SH3-domain 0.00038
Further Details:      
 
Domain Number 3 Region: 240-324
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-18
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 4 Region: 806-866
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-17
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 5 Region: 409-497
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1013-1077
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000276
Family SH3-domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358789
Sequence length 1079
Comment SH3PXD2A (Homo_sapiens) SH3 and PX domains 2A
Sequence
VYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRS
HIRDVAVKRLKPIDEYCRALIRLPPHISQCDEVFRFFEARPEDVNPPKDSRRKSVWLSSW
AESPRKDATGADTSAEPMILEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVST
SEEQGWVPATYLEAQNGTRDDSDIHTSRTGEVSKRRKAYQRRLDRRWTLGGMVNRQHSRE
EKYVTVQPYTSQSKDEVGFEKGVTVEVVRKNLEGWWYIRYLGKEGWAPASYLKKAKDDLP
TRKKNLAGPVEIIGNIMEISNLLNKKDKETLPTEGEGSEAPAKKEISLPILCNASNGSAS
GVPERSISRLAQGSPAVARIAPQRAQISSPNLRTRPPPRRESSLGFQLPKPPEPPSVEVE
YYTIAEFQSCISDGISFRGGQKAEVIDKNSGGWWYVQIGEKEGWAPASYIDKRKKPNLSR
RTSTLTRPKVPPPAPPSKPKEAEEAPADASESQESPLKLKYEEPEYDIPAFGFDSEPELS
EEPTEDRAPGDRRPAQPRRPSPAASLQRAHFKVGASSEDVALEEETIYENEGFRPYAEDT
LSARGSSGDSDSPGGSSLSLGRKNSPKSASLLKLKAENAQAGLGKNHSSASFSSSVTINT
TCSSSSSSSSSSSPSSSLCKNSGDLKPRSASDAGVRGTPEAGAKTDADPKAGLASCTRAK
PSLRPKPILSRAESQSREKMDISTLRRQLRPTGQVRGGLKGSRSEDSELPPQAASEGPGQ
GPRRGSADVISVSLASACAPRKEPAAAASYVACSAYQKVQESELSFPAGAAVQVLEKLDS
GWWYVRFGGLEGWAPSHYLVPEQPEAAGSGPSEGRSDSLEQLERRVQALNTVNQSKRATP
PVPSKPPAGAAAVQMRNGVRQAAVRPQSVFVSPPAKDNNLSCALRRNESLTASDGLRVRR
NSSFSSARSAAAEAKGRLGERAARQGSDCPLPPSQRSCVAVSPVRPKPIEKSQFIHNNLR
DVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDEVKPFRGWVPSNYLEKKN
Download sequence
Identical sequences G5CAJ8
HGL_H00000358789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]