SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358799 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358799
Domain Number 1 Region: 739-911
Classification Level Classification E-value
Superfamily SPOC domain-like 1.14e-50
Family SPOC domain 0.00013
Further Details:      
 
Domain Number 2 Region: 330-484
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.03e-27
Family Canonical RBD 0.0025
Further Details:      
 
Domain Number 3 Region: 66-204
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000645
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358799
Sequence length 913
Comment RBM15 (Homo_sapiens) RNA binding motif protein 15
Sequence
MKGKERSPVKPKRSRGGEDSTSRGERSKKLGGSGGSNGSSSGKTDGGGGSRRSLHLDKSS
SRGGSREYDTGGGSSSSRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGG
DGGEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRR
PEDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPP
GGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRELERERDYPFYERVRPAY
SLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEV
DIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLG
PWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLR
VDFADTEHRYQQQYLQPLPLTHYELVTDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPD
SDWVPPPPPVRERSTRTAATAVAAYESLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRR
LPEESGIRHLDRSPESDRPRKRHCAPSPDRSPELSSRDRYNSDSDRSSRLLLERPSPVRD
RRGSLEKSQGDKRDRKNSASAERDRKHRTAAPTEGKSPLKKEDRSDGSVPSASTASSKLK
SPSQKQDGGSAPAATASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGG
KVAQLKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSDTATST
QRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSE
EDYLVMIIVRGAS
Download sequence
Identical sequences G5BD76
HGL_H00000358799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]