SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358802 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358802
Domain Number 1 Region: 197-450
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-56
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 36-126
Classification Level Classification E-value
Superfamily POZ domain 9.16e-30
Family Tetramerization domain of potassium channels 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358802
Sequence length 624
Comment KCNC4 (Homo_sapiens) potassium voltage-gated channel, Shaw-related subfamily, member 4
Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWPADPFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCW
MTYRQHRDAEEALDIFESPDGGSGGAGPSDEAGDDERELALQRLGPHEGGAGPGSGSGGC
RGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEIHRVGN
ITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPF
YLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLI
IFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPK
TWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPAQLESP
LYCKSEETSPRDSTYSDTSPPAREEGMVERKRADSKQNGEANVVLSDEEGAGLTQPLASA
PTPEERRALRRSGTRDRNKKAAACFLLSAGDYVCADGSVRKVSTTALTQSPGHLDCQALT
VDMCLRWQKQQQQSATWKEMAWRP
Download sequence
Identical sequences G5BD75
HGL_H00000358802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]