SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358861-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000358861-2
Domain Number - Region: 168-246
Classification Level Classification E-value
Superfamily Tropomyosin 0.00687
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358861-2
Sequence length 248
Comment LCA5 (Homo_sapiens) Leber congenital amaurosis 5
Sequence
MGERARSTDSDQESKTGRHHSCYYSSDFGTTSQSSGQSSPVHPSPENIRGENPTRQMSDN
QVHHQAPRKPSPKGAPDKKGAQLGFRSQSLNREPLWKDPDLVTKWVLSARLLKISALQNE
VSEGQVKLADLLKENKALKRVQYRQEKVLNKFGDAENEISQLISSHNNEITVLKECLRKS
QEKEQATEKRVKDTESELFRTKSSLQKLKKISEARHLPKRDDLAKKLVSAELKLDDTERR
IKELSKKS
Download sequence
Identical sequences G5C026
HGL_H00000358861-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]