SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358939 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358939
Domain Number 1 Region: 153-417,446-485
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.6e-81
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000039
Further Details:      
 
Domain Number 2 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000194
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358939
Sequence length 538
Comment SARS (Homo_sapiens) seryl-tRNA synthetase
Sequence
MVLDLDLFRVDKGGNPDLIRESQEKRFKDPGLVDQLVKADSEWRRCRFQADNLNKLKNLC
SKTIGEKMKKKEPVGDDDSVPENVLNFDDLTADTLASLKVSQIKKVRLLIDEAILKCDAE
RLKLEAERFEKLREIGNLLHPSVPISNDEDADNKVERIWGDCTIRKKYSHVDLVVMVDGF
EGEKGAIVAGSRGYFLKGSLVFLEQALIQFALRTLASRNYIPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYASPHDSKSWEMFEEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGKTKKMMDKR
RKNLYLPTQNNFVAVPSLFSPKKVEFVHMLNATMCATTRTICAILENYQTEKGIIVPDKL
KEFMPPGLQELIPFVKPAPIDQEPSKKQKKQHEGSKKKVSTRDATLENQLQNMEVTDA
Download sequence
Identical sequences G5BQV7
HGL_H00000358939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]