SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359252 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359252
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.55e-56
Family DnaQ-like 3'-5' exonuclease 0.00000000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359252
Sequence length 236
Comment TREX2 (Homo_sapiens) three prime repair exonuclease 2
Sequence
MSKPPRAETFVFLDLEATGLPNMDPEIAEISLFAVDRSSLENPERDESGAPVLPRVLDKL
TLCMSPQRPFTAKASEITGLSSEGLARCRKAGFNGAVVRTLQAFLSRQEGPICLVAHNGF
DYDFPLLCTELQRLGAHLPQDTVCLDTLPALRGLDRAHSHGTRAQGRKGYSLGSLFHRYF
QAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARSWAHIEPMYAPPDGPSIEA
Download sequence
Identical sequences G5B4W7
HGL_H00000359252 XP_004874976.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]