SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359506 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359506
Domain Number 1 Region: 200-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 266-311
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000725
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359506
Sequence length 616
Comment FMR1 (Homo_sapiens) fragile X mental retardation 1
Sequence
MWTSFSLFAVLTTCIARAQYTVGNGAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPP
VGYSKDINESDEVEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKDTFHKIKLEVPED
LRQMCAKESAHKDFKKAVGAFSVTYDPETYQLVILSINEVTSKRAHMLIDMHFRSLRTKL
SLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLD
EDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRV
RIEAENEKNVPQEEEIMPPNSLPSNSSRVGSNTSEEKKHLDIKENSANFSQPNSTKVQRV
LVVSSIVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYHLNYLKEVDQLRLERLQ
IDEQLRQIGASSRPPPNRTDKEKGYVTEDGQGMGRGSRPYRNRGHGRRGPGYTSGTNSEA
SNASETESDHRDELSDWSLAPTEEERESFLRRGDGRRRGGGGRGQGGRGRGGGFKGNDDH
SRTDNRPRNPREAKGRTADGSFQIRVDCNNERSVHTKTLQNTSSEGNRLRTGKDRNQKKE
KPDSVDGQQPLVNGVP
Download sequence
Identical sequences G5BKA1
HGL_H00000359506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]