SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359665 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359665
Domain Number 1 Region: 48-184
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0000233
Family ADP-ribosylating toxins 0.028
Further Details:      
 
Weak hits

Sequence:  HGL_H00000359665
Domain Number - Region: 200-284
Classification Level Classification E-value
Superfamily Lipocalins 0.0684
Family Retinol binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359665
Sequence length 421
Comment PI4K2A (Homo_sapiens) phosphatidylinositol 4-kinase type 2 alpha
Sequence
MDETSPLVSPERAQPPEYTFPSGSGAHFPQAQALAAQAAAAAHAAQAQDPEFEAVVRQAE
LAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCC
FGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLAL
EKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLV
VLDYIIRNTDRGNDNWLIKYDCPMDSSTSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDS
WRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHK
QIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSASESYTQSFQSRKPFFSW
W
Download sequence
Identical sequences G5C0B7
HGL_H00000359665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]