SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359691 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359691
Domain Number 1 Region: 265-590
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.28e-59
Family Glutamine synthetase catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 211-264
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000000000615
Family Glutamine synthetase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359691
Sequence length 593
Comment LGSN (Homo_sapiens) lengsin, lens protein with glutamine synthetase domain
Sequence
MSFVGLGFAVFVPSGTCDATVVSGTPQVLDVQWYRILNREKEYEEQEEMREDEVLKKRRR
RNMAVSERKDSCEERTRNQMLCHKLGDSSKPAESHLSHDDKDAQDWTTATKTSPPKIATH
ALVDEFNPNSDRARNSTQILTPPQLSSKMKHIKQEMTKNHLQFVRFEATDLHDLAEPGRM
GFENMQQLERGKQWLQAQGSGTVTAVCINAPGSMADDEVNHIRATCFNSDVVLRPELCTF
RVLPWVPRTARVICDTFTVTGEPLPTSPRCIAKRQLSQLQDAGFSLLSAFLCDFCVFGVS
EVINSKAVSFPVPAFLDNHDQPFMQELVNGLCHTGATVESFSSSTRPGQMEICFLPEFGI
ASADNAFTLRTAVKEVARKYNYIASFFLETGFCNSGILSHSVWHVSGKKNVFCSSPGAEL
LTPAGQKWLAGLLKHSPALSCLLAPDVSCRKCYCKDSKDPKTTVPVAWGYNDNSCAFNIK
SHGGRGTRIENKLGSATANPYLVLAATIAAGLDGLQSCDSAVAGEGDSTGLCQAQQATIP
VKLEDALMALEEDQCLRQALGETFIRYFVAMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences G5BZQ7
HGL_H00000359691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]