SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359802 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359802
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-38
Family SCAN domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 137-181
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359802
Sequence length 190
Comment ZNF75D (Homo_sapiens) zinc finger protein 75D
Sequence
MMTSELKEDACLNPHMGAVWETKGSVKDSSSQSKQNSLQIKHLCPESARQHFRSFCFREA
PGPLEAVSQLQELCHQWLRPEIHSKEQILELLVLEQFLTILPREIENWVQKHHPQNIRQA
VVLVECLQRESGGTKNENLLTFEDVAVYFSEEEWQLLDPNQKALYNDVMQDTYETASFLG
KDFSFSLCTS
Download sequence
Identical sequences G5AX34
HGL_H00000359802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]