SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359805 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359805
Domain Number 1 Region: 28-291
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.39e-86
Family Calponin-homology domain, CH-domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 2473-2690
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-44
Family Plakin repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 2695-2877
Classification Level Classification E-value
Superfamily Plakin repeat 3.66e-37
Family Plakin repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 307-423
Classification Level Classification E-value
Superfamily Spectrin repeat 9.93e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 5427-5587
Classification Level Classification E-value
Superfamily Spectrin repeat 2.8e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 6143-6293
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-21
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 4965-5124
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-20
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 1276-1404,1431-1459
Classification Level Classification E-value
Superfamily Spectrin repeat 6.52e-16
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 9 Region: 741-843
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000121
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 10 Region: 5696-5810
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000192
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 4731-4853
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000111
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 12 Region: 5334-5445
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000683
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 13 Region: 5176-5296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000013
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 5559-5661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 15 Region: 648-739
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000432
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 16 Region: 4873-4978
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000139
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 823-923
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000259
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 18 Region: 1974-2223
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000249
Family Tropomyosin 0.00071
Further Details:      
 
Weak hits

Sequence:  HGL_H00000359805
Domain Number - Region: 4297-4409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000196
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1071-1211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00152
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 1713-1967
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 4498-4613
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0115
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 2385-2481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0936
Family Spectrin repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359805
Sequence length 6294
Comment DST (Homo_sapiens) dystonin
Sequence
MSSGNASYRCSMSSSVDFSDEDDFSQKSGSASPAPGDTLPWNLPKHERSKRKIQGGSVLD
PAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDT
LPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQIS
DIHVTGESEDMSAKEKLLLWTQQATEGYAGIRCENFTTCWRDGKLFNAIIHKYRPDLIDM
NTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEG
DEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTIMSERTFPNNPVELKALYNQYLQFKETE
IPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEREWGKLIIAMLEREKALRPEV
ERLEMLQQIANRVQRDSVICEDKLLLARNALQSDSKRLESGVQFQNEAEIAGYILECENL
LRQHVIDVQILIDGKYYQADKLIQRVAKLRDEILALRNECSSVYSKGRMLTTEQTKLMIS
GISQSLNSGFAQTLNPTLTSGLPQSLTPSLTSSSVTSGLSSGMTSCLTPSVTPAYTPGFP
SGSIPNFSSGVEPNSLQSLKLMQIRKPLLKSSLLDQNLTEEEVNMKFVQDLLNWVDEMQV
QLDRTEWGSDLSSVESHLENHKDVHRAIEEFESSLKEAKISEIQMTAPLKLTYTEKLHRL
ESQYAKLLNTSRNQERHLDTLHNFVTRATKELIWLNEKEEEEVAYDWSERNTHISRKKDY
HVELMRELEQKEENIKSVQEIAEQLLLENHPARLTIEAYKAAMQTQWSWILQLCQCVEQH
IKENTAYFEFFSDAKEATDYLKNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQY
KNTVASLMGRAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRA
KWKVISPTGNEAMVPSVCFTVPPPNKEAADCANRIEQQYQNVLALWHESHVNMKSVVSWH
YLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSHFEDFLEDSQESQIFSGSDIAQLEKE
VNVCQQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLH
ESVFRIAEQEKLRKELERLKDDLGSITNKCEEFFSQAATSPSVPTLRSELSVVVQNMNQV
YSMSSTYIEKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRS
EVDEKREVFHALEDELQKAKTISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDN
RLRDLEGIGKCLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSE
IEMKQNKMDECQKYAEQYSATVKDYELQTMTYWAMVDSQQKSPVKRRRMQSSADLIIQEF
MDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEMKRCKETSEYGAYSDLLQRQKATVIENS
KLTGKIKELEKMVAELKKQKSRVEEELPKVKEAAEIELRKQQRNVEDIALQKIRAESEAQ
QYRRELETIVREKEAMELELERVRQLTLEAEAKRVAVETNLLNFQSQLEQNTFTRRTLED
HLKRKDSNLNDLEQQKNKLMEELRRKKDSEEELLKLVKQMERDLTFQKQVAEKQLKEKQK
IELEARRKINEIQYSYRENTLPACAITQPMSRMGIEGFQKEYDKQKAEELRQQVDELTIA
NRRAERDMRDLKYELNALQLEKTSSEEKARLLKDKLDKTDNALKYLKLELERKDQVEEGY
SQQLRELSRQLNQTTDKAEEVMQEANDLKKIKESYQLELESLHHEKGKLQKEVDRITRSH
AIAERDIQYLNSQIHSFQDEKEFCKERRQLSQRKSDHLKEQFEKSHEQLLQNIKAEKENN
DKIQKLNKELEKSNECAEMLKQKVNELTRQNNETKLMMQRIQEESKNVVLEKQAIQQRCE
VLKTQADGFKDQLRNTNEHLHKQTKAEQDFHRKIKSLEEDLVKSQNLVSEFKQKCDQQNI
IIQNTEKEVRNLNAELNASKEEKRRGEQKVQLQQAQVQELNNRLKKVQDELHLKTIEEQM
THRKMALFQEESDKFKHSAEEFRKKMEKLMESKVITEKDISGIKFDFASLQQENCRAQEN
AKLCETNIKELESQLQQYREQMQQGKHVEANHYQKCRKLEDELIAQKCEVEKLKKKMDQQ
IKEHEHQLVLLQCEIQKKNIGKDCTYTPDFEVTVREHQHSGELLCRSTGHLRARSPLLRW
PEEPQQVEEKWQHQVVEQIPKEVQFWPPGAPLEREKSQQCYSEYFSQTSTELQITFDETN
PVTRLSEIEKIRDQALHNSRPPVRYQDDKHEMELVKLLTPLEKSLEEEKKDHVDKAKELQ
KWLSSISKTLRDGEKAGKSPFSKQKIPSEELSTKKEQLSEALQTMQLFLAKHGDKMTGEE
RKELEEQVKTLKEGYNLLFSESLKQLEVSQTSGDIIVEEKLNKVIAGTIDQTTGEVLSVF
QAVLRGLIDYDTGIRLLETQLLISGLISPELRKCFNLKDAKSHGLIDEQILCQLKELNKV
KEIISASSSTKIPVLDALAQGMISEPMAIKVLEILFSTGFLVIPATGEHLTLQKAFQQNL
VSSALFSKVLERQNTCRNLIDPFTSEKVSLIDMVQRSILQESTRMWLLPVRPQEGGRITL
KCGRSISILRAAHEGLIDRETMFRLLGAQLLSGGLIECTSGQKLTVEEAMAKGVIDGNTA
HSILTYQVQTGGIICSSPAKRLTVDEAVQCNLITSISALLVLEAQQGYVGLIWPHTGEIF
PTSSSLQQELITNELAYKILNGRQKIAALYIPESSKVIGLDVAKQLGIIDNNTASILKNI
VLPDKMPDLGDLETCKNARRWLSFCKFQPSTVHDYRQEEDVFDGEESMAIQSSEQTEKLF
LSYLMVNSYMDASTGQRLLLYDGDLEEAVGMLLEGCSAEFGEDTPINDSLDVLGCPDLFL
NLASSKEKNECTASTTRSDKCRCREPGHTETPKNQKGVIDEKFDEMGNNGISSKFCQSEN
MANIAADQEVNTSFSMCIPNPMSYVKQTEPTESSMLRHDSGNILDNCENQSQNFANDLIT
SPVMKSKTDGLCDISETKNEDNINQDSSIFDYSPRLSTLLSHDKLRHNQKSFNDVHTPES
DGSQYEASLSLSNENMLSDQRMGESFQDQFLGIAAINITLQGEHGEQKSLNIACRNLQVQ
YPSDKYMSDTFGENEQMRTASQQKPIGKQNVSEMEEFFGAMTQGCSTDDASACHICGTPV
LEETISAGDYETSLLDDQQSDAGTDTDSDDDFYDTPLFEDDDHDSLLLEGDIRDCLQPED
YDTLQEENDGMVLPVDVFYDISKENESSVVPQGGLAGNVNVRDKAQCLQDFLTGIEKAEL
DSSDRKYLSSVSSDKVNEWSMETLSEREHTNYLEGGESDSLTDCEIVGSKGSCGDSLEFD
DAGSWRRKEYVIGQSDTDHFDSMQSEQSYGDCTSDSNDQDDDDYDGDDGDDEEGEVGDEN
GKSVCQDKAEDNQLCSMAVKQNSGENQSTKMLLLDKMCDSSSLVTQQSISVLQLESTRKS
ILVTERNNLQEHTTGDVGKREENLLSHEVVLIDTLLPVTKDTESGKIFRPEGILHSSVSS
VSELEGDLMNTKIKVTQGPGSVCLENVTAKINPSFDKIICSQPELIGKPKENQLSFTASI
TGRDHQGNGRDPVKGKDDKISILMEGAMSAHKTHLGKEVLTGGPEEEENKYLKLPLNKST
RESLNLVKSQYPFPKITNNEDLDQKGSLEKATGTLKEKPKNVQTVVSKSPVQFEDLEEIF
VTPVSKVICDDITSGVGLSEGSNTTEKDSFTDAPEKELDLLTFLKYGAKNIKAKDVLKPS
ENTPGHVSIADLSMREDLQLGVNITKDNLTPTQEDQPQNKKLHHSDLITKENVSQGETEI
PQFTSENNEVILPVLTLKNVEDLGENADNMQSEVCISEIRNDNSSNTLDTDYSFLNINSK
KEGIEKQPPREQTLSPEHQEKMRQIAELSQVFVENVKDILKSKLKSNMNPQEVGDPSACA
DSEALIPILIKKISSLHLVNETSNVPNNLKISDYSGVSPINNSSELKAEGRDDSFYIANV
NSELLLDTLKQNQHSPKITGVFELMRELTQMEYDLEQRDTSSKVLPVQLENAFCKRLADG
DSEKEQMRDLSQKACTTFEIVEEKPHIFGDVKSKEGNYCSPNLQTIQEMRLESSVVCGSD
LPRDERLEDLCSDFPNHLGCIAGLKEMTSGDSSMEKFSNELQQCLQHTEKMHEYLALLQD
MTPPLENQESVDNNLEALKNQLKHLETFELRLSPIAVILRKSMKSAEEFSKSLPSDFPRI
YLEELSISHQSLQTAFSSLSNVSSERIKQIMLAIDSEMTVLKDLGHTKMQLETTAFDVQF
FISEYAQDLSPNQSRQLLRLLNATQKCFLDVQASVTMQVERLEMQLQLEQDLDDQKTTAE
HQQEYKEKLQGICDLLTQTENRLIGHQEAFVIGDGTVELKKYKSEQEELQKDMQGSAQAL
AEIVKNTENFLKENGEKLSQEDKALIEQKLSEAKIKYEQLNLKAEQSKKELDKVVKTAIK
EETEKVAAVKQLEESKTKIENLLDWLSNVDKNSGIKHKQVIEQNGTHFDEGDGKSVIGEE
DEVNGNLLAADVDVHLGVTEENLNQQYQKIKAQHEQIISRHQAVIIATQSAQALLENQGH
YLAPEEKDKLQKNMKELKAHYETTLAESEKKMKLTHSLQEELEKFDADYGEFEHWLQQSE
QELENLEAGVDDFSGLLTKLNRQKSFSEDVISHKGDLRFITISGNRVLEAAKSCSKRDGN
KVDKDNVDTSATHREVQSKLDHATDCFRSLYSKCNILGNNLKDLVDKYQHYEDASCGLLS
ALQVSEALANKHLFEPIAVDPQNLQRQLEETKALQGQISSQQVAVEKLKKAVEVLLDARG
SLLPAKNDIQKTLDNIVGRYDDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGSVES
SVKEQDQVPLNSAALQDLISRNIMLEQDIAGRQSSINAMNEKVKQFMETTDPSTASSLQA
KMKDLSVRFSEASQKHKEKLAKMEELKTKVEMFESLSEMLQTFLETKTQALTEVDVPGKD
VTELSQYMQAKHKKDLEALHNLLMEISSQGLPGDKALVFEKTNNLSKKFKEMEDTIKEKK
EAATSCQEQLEAFQVLVKSLKSWIKETTEQVPILQPSFGAEDLGKSLEETKKLQEKWSLK
TPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGVILNGEGTDTNTQDFLTSKGLTSIK
KDMTDISHGYEDLGLLLKDKIAELNTKLFKLQKAQEESSAMMQWLQKMNMTATKWHQTPT
PADTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDIPEAPKWKQILTEIDS
KWQELNKLTVDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQ
RQQVQILLQEFDTRKPQYELLRAAGQSILSRPGEDPSLHEVVKEQLAAVTQKWDGLTGQL
SDRCDWIDQAIIKSTQYQSLLRSLSSKLSKLESKLSSSLAVSTLPDAMNQQLETAQKLKQ
EIEQETQQIKVAQALCEDLSALVKEEYLKAELSRQLDSILKSFKDIEQKAENLVQHLQSA
CASSHQFQQRSRDFQAWLDTKKEEQKKSHPVSARLEVLESLIKDQKDFSKTLAAQFSIYE
KAIAEGENLLLKTQGSEKAALQLQLNMIKNNWDGFNKQVKEREDKLKDSLEKALKYKECV
ETLHPWIDKCQNSLEVFKFCLDPANGYERQAPGADVTAGFLQLRASSVFELRGREANKLD
EKMIFDALKLNSDIIRTTGLSKAKSHAEKKEHRRSWRMFVPANFMDYANKSESSFVEPID
MSDAVTRTSKCRQGANSLTSEEDDSGLCSPPAEREKQGFLNGDWSRIRGLSSAEDIHITE
QYRPFLSVNSISEQKIPLLSCRSAHPEDNFKMILHNVSPLEGTQCVNGQKAIQCCLQDDL
KDNTQCDPLTMPRDGENEHLSNPGQEQTYQPGDSQIIVQVRKRATSRKTEGQEGMLDTVC
NGFQSGQVFQKEEIEPLQVKQQDVNWLGQGLIHSAAKNTSTQGLEHDLEDVSARWKILNK
KVAQRAAQLQEALLHCGRFQDAVESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLL
QRLLDDRRSTVEAIKREGEKIAATAEPADKVKILKQLSVLDTRWETLLNKAEMR
Download sequence
Identical sequences G5BR15
HGL_H00000359805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]