SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359965 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359965
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000326
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359965
Sequence length 502
Comment ENOX2 (Homo_sapiens) ecto-NOX disulfide-thiol exchanger 2
Sequence
MDGWTDLPPPATRERPPGCKTVFVGGLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIR
FAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHR
RRMEEERLRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANN
FYSMIQSANSHVRRLVNEKATHEKDMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAW
DHFTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEETAETKETEESALV
SQAEALKEENDSLRWQLDAYRNEVELLKQEQGKAHRDDDPNKEQQLKLLQQALQGMQQHL
LKVQEEYKKKEAELEKIKDDKLQVEKMLENLKEQENCASRLCASSQESDCPLEKTMNSSP
IKSEREALLVGIISTFLHVHPFGASIEYICSYLHRLDNKICTSDVECLMGKLQHTFKQEL
TGVGASLEKRWKFCGFEGLKLT
Download sequence
Identical sequences G5AUC5
HGL_H00000359965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]