SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360108 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360108
Domain Number 1 Region: 801-978
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.28e-48
Family Chaperone J-domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 81-132,179-284
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.41e-23
Family Dual specificity phosphatase-like 0.0015
Further Details:      
 
Domain Number 3 Region: 292-429
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.14e-21
Family PLC-like (P variant) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360108
Sequence length 978
Comment DNAJC6 (Homo_sapiens) DnaJ (Hsp40) homolog, subfamily C, member 6
Sequence
MRPAVSAGPGEPAPAVTWGGDIWGSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLK
DTLKDTSSRVIQSVSSYTKGDLDFTYVTSRIIVMSFPVDSVDIGFRNQVDDIRSFLDSRH
LDHYTVYNLSPKSYRTAKFHSRVFRLRSPEPLTHVYPIARWPDLCHPFLQLLARLPPATL
LCEPERPWKVSECSWPLRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILV
GAMFIFCNLYCTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYHPHFKPLTMKS
ITVSPVPFFNKQRTGCRPYCDVLIGETKIYSTCTEFERMKEYRVQDGKIFIPLNITVQGD
VVVSVFHLRSTIGSRLQAKVTNTQILQLQFHSGFIPLDTTVLKFTKPELDACDVPEKYPQ
LFQVTLDVELQLQDKAVDLTPPWEHCCTKDVSPSVLFSSHQEHQDTLALGGQAAVDAPPD
TPRHPGQGGFFSSLCWQDQKPEKSCEEDHAALVNQESEQSDDELLTLSSPHGSANGDRQH
GPKRPSKKQQEPVVPPAPEEVDLLGLEGSDVSQSFSPQAPPPTNTELLSDLDLFGGTGAA
GPAPAGQSGVEDAFHPSGAASAQSTPRRSASSSASPTLRVGEGATFDPFGAPAKPSGQDL
LGSFLSTSSASSDPFLQPTRSPSPTVLASSTPAVSIQPDVLGGWDWHAKPGGFGMGSKSA
ATSPTGSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASP
QPMGSGWQQGGGYSWQQSQSKLQPSMPHSSPQNRPNYNVSFSSVPGSQSERGKGPTNLEG
KQKAADFEDLLSSQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRA
LLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFM
ELNDAWSEFENQGQKPLY
Download sequence
Identical sequences G5BSN9
HGL_H00000360108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]