SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360113 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360113
Domain Number 1 Region: 317-500
Classification Level Classification E-value
Superfamily vWA-like 0.00000000136
Family Integrin A (or I) domain 0.049
Further Details:      
 
Domain Number 2 Region: 803-913
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360113
Sequence length 1426
Comment CACHD1 (Homo_sapiens) cache domain containing 1
Sequence
MLDTVPPAAEVARGGEALHGPGTDRSLRQRVTMARAILSLLLSAVYDIYAAQFCCLVLPQ
PRPRCQCPPRTLSQLPNQLAKKIREKFNRYLDVVSRNKQVVEASYTAHLTSPLTAIQDCC
TIPPSMMEPVQSRFGVLSPKCGARTVPVYTLAVLVIVCGRVPVQELRLVLADNLKSNPGI
KWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRETQVWMDLIAWRLGSAQAVVADLRELSAP
RGKGLLLQGEEPDLSPEPLCELLGPDMRWVYTENPVLGTAPSLPGGPSSSRRQNGREGST
GLQRHGPIYVSTVRPQSKHIVVMLDHGSSVTDTQLQIARDAAQVILRAIDEHDKISVLTV
ADTVRTCSLDQCYKTFLSPATSETKRKMSTFVGSVKASDSPTQHAAGFQKAFQLTRSTNN
NTRFQANTDMVIIYLSAGVTSKDSSEEDKKATLRVINEENSFLNNSVMILTYALMNDGVT
GLKELAFLRDLAEQNSGKYGVPDRSALPVTKGSMMVLNQLSNLETTVGRFYTNLPNRMID
EAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFL
IDDKGYTLMHPSLSRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQTISVPVNS
SLSWHINKLREAGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLY
HRLDLLGQPSACLHFKQLATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNT
RLIANPGLKFSVRNEVMATSHVPDEWMAQMEMSSLSTYIVRRYIATPNGVLRIYPGSLMD
KAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMG
IDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITH
KEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARI
PGTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTHA
ESRNPSCEVHQEPVTYTAIDPSLQDALHQCVNSRCSQRLESGDCFGVLDCEWCVVDSDGK
TQLDRSYCAPQKECFGGIVGAKSPYRNDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMV
LVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIA
AVMERHAHSPERRRRYWGRSGTESDHGYSTMSPQEDSENPPCSSDPLSAGVDVGNHDEEL
DMAAPPQTAALLSHKPHHCRPHHAPLHHSHHLQNPCQRMCWGLTSACAHVLSGRGQSPAG
EGAELAYRAPQTEPGLGEDEAGSVQEPARPSTRRGHESQPKSSTGR
Download sequence
Identical sequences G5BSN4
HGL_H00000360113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]