SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360120 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360120
Domain Number 1 Region: 429-718
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-71
Family Protein kinases, catalytic subunit 0.000000393
Further Details:      
 
Domain Number 2 Region: 272-355
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-34
Family Kringle modules 0.00075
Further Details:      
 
Domain Number 3 Region: 32-124
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-21
Family I set domains 0.033
Further Details:      
 
Weak hits

Sequence:  HGL_H00000360120
Domain Number - Region: 140-227
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00249
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360120
Sequence length 899
Comment ROR1 (Homo_sapiens) receptor tyrosine kinase-like orphan receptor 1
Sequence
ETELSVTAELVPTSPWNISSDLDKDSYLTLDEPMNNITTSLGQTAELHCKVSGSPPPSIR
WFKNDAPVVQEPRRISFRATSYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKF
GPPPTASPGSSDEFEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG
TSSHLSDKCSQFAIPSLCHYAFPYCDETSAVPKPRDLCRDECEILENVLCQTEYIFARSN
PMILMRLKLPNCEDLPQPESPEAAHCIRIGIXHKCYNSTGVDYRGTVSVTRSGRQCQPWN
SQYPHTHTFTALRFPELSGGHSYCRNPGNQKEAPWCFTLDENVKSDLCDIPACDSKDSKE
KNKMEILYILVPSVAIPLAIAFLFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNA
YKPKSKAKELPLSAVRFMEELGECALGKIYKGHLYLPGMDHAQLVAIKTLRDCGSPQQWA
EFQQEASLLAELHHPNVACLLGAVTQEQPACMLFEFLNQGDLREFLIMRSPHSDVGCSSD
EDGTVKSSLDHADFLHIAVQIAAGMEYLSSHFFVHKDLAARNVLMGEQLHVKISDLGLSR
EIYSADYFRVQSKSLLPIRWMPPEAIVYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSN
QEVIEMVRKRQLLPCSEDCPPRMYSLMTECWHEVPSRRPRFKDIHVRLRSWEGLSSHTSS
TTPSGGNATTQTTSLSASPVSNLSNPRFPSYMFPSQGLPAQGQIAGFIGPPIPQSQRFIP
INGYPIPPGYAAFPAAHYQPTAPPRVMQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQ
EANIPLLPHLSLPSHPGGMGLAVFGNKAQKPYKIDSKQPSLLGDANIHGHSESMISAEL
Download sequence
Identical sequences G5BSN3
HGL_H00000360120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]