SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360293 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360293
Domain Number 1 Region: 1392-1470
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-20
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 2 Region: 1841-1899
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-20
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 1470-1559
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-18
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360293
Sequence length 1901
Comment SORBS1 (Homo_sapiens) sorbin and SH3 domain containing 1
Sequence
MDVSSFVTPILVLDQQGKRPEEEYDLEVVIRKNAAIYSGRPFLQASPVSSRFLSGDSNFL
PFASLILARVLEKLSLELLSESFPQSSDNFGLPICPFKSFASHHSAASNFVTGSLGCLVQ
PSNIKSSSESPLQKICPATTMNSKCDVGTSRAVVNGLTPGSNGQDKATADPLRARSISAV
KIIPVKTVKNASGLVLPPDMDPTKICTGKGAVTLRASSSYGEAPTSSPVSPQETLEHESK
PGQEPENSSADDWRLSSSADANGNAQPSSLAAKGYRSVHPSLLADKPQDATSSSPAQPEV
IVVPVYLVNTDRGQEGTARPPASLEPLGCIHTTLVTTPAASPLTFPTLDDFIPPHLQRRP
QHSQPASACGSLSPVSQTPPSFSPPPPLVPPIPEDLHRVSKPDLTGAVSSTRSSPLLNEV
SSSHIATDSQAFPPASKTSSAYPSTTIVNPTIVLLQHNREQQKRLSNLSDPVSERRVGED
SSPTQEKPTSPSRTAEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFR
QIHKLNRDTPEENPYFPTYKFPELPEIQQNSEEDNPYTPTYQFPASTPSPKSEDDDSDLY
SPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSSPERNDWEPPD
KKVDTRKYRAEPKSIYEYQPGKSSVLNNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPT
NLEKDLNLCQTELEADLEKMETINKAPNSNSPQSSAVSPTPDISSEPPGYIYSSNFHAVK
RESDGAPGDLASLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKVDRKGGNAHMISS
SSVHSRTFHTSNALGPGCKHKKPLSAAKACISEILPSKFKPRLSAPSALLQEQKSVLLPS
EKAQSCENLCVSVSLNDSKRSFPLQVGGSIENLLMRSRQDYNSKSSSTMSLQEYSTSARR
PCALSRKAGLQFTMFYRDMHQINRAGLSLGSISSSSVRDLASLFERNSLALARGELGPSQ
EGSDHIPKHTVSSRITAFEQLIQRSRSMPSLDLSGRLSKSPTPVLPRNGLTSARSAESLL
ESTKLRPREMDVMSTSGVYAAPTCSNIADHTLGFRGLMPSEPLSTCSDELDHLSNISSDS
REGSSSSIHGDFPKHRLNKCKGTCPASYTRFTTIRKHEQQQSSRQPDWRLDSRGDKSALL
RNIYLMSPLPFRLKKPLQHHPRQPSPAGSSGFLVGQRPDLPSQPHQDQVPSSGKPLVPTR
LSSWHTMARLSRSSEPPKERPVVLEDCSRAINNGDSVPYSDHGLDRNNNPQSKLAPSLRD
SESPRHFIPADYMESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQ
FITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNW
YEGEHHGRVGIFPCTYIELLPPAEKAQPKKLPPVQVLEYGEAIAKFNFNGDTQVEMSFRK
GERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVLKRPLVKNPVDYIDLPYSSSPSQSA
TASPQCPRYSKIIMPAPSSLPHPRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPL
PEASIYDTDSLILSTRACPSLPVSLPHWSCSNHSTPHSVVSPLALPAPQKAYSLAPSSQA
PLHVNRNGGIHMPSSGIHQDSYSQLLFGSSDRVISELSGAFSSQSKLQPWLEENGQYERK
AESEAGERCPGGPKISKKSCLKPSDVVRCLSTEQRLSELHTPEESRPSKPLGSTFPGREA
GQTELHRGGEAERRAAQSGTSQQPQAQQRRITPDRSQTSQDLFSYQALYSYTPQNDDELE
LRDGDIVDVMEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
Download sequence
Identical sequences G5C153
HGL_H00000360293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]