SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360302 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360302
Domain Number 1 Region: 254-368,490-524
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.32e-36
Family Phosphate binding protein-like 0.000000894
Further Details:      
 
Domain Number 2 Region: 1-239
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-32
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 391-487
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000406
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360302
Sequence length 527
Comment GRIA3 (Homo_sapiens) glutamate receptor, ionotrophic, AMPA 3
Sequence
GFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTI
LEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANVTGFQIVNNENPMVQQFIQRWVR
LDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWS
QGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFS
DQQISNDSASSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIK
YKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLG
ISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEE
PRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYT
ANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRVSTL
Download sequence
Identical sequences G5AP06
HGL_H00000360302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]