SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360389-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000360389-1
Domain Number - Region: 255-301
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0732
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360389-1
Sequence length 371
Comment TMEM59 (Homo_sapiens) transmembrane protein 59
Sequence
MLHRNKYRQTAMDQRGAASRGGRDWGGGCGPQHRLLSSFKTFNWIDGLCSDSKTLQSRTA
VPAQLDRGDAARTGGLSVAKEVASGVTCGLQQEKACISLLAKVKCKNIPKRDPKTRVYKG
SPDCQSDHGIKMMKHLCFIEHEWPQSQLPFAELRQEQLMSLMPKMHLLFPLILVWSFWSD
MMGSAQSFITSSWTFYLQANDGKILIFQSKPEIQYAPQLEQGPTNLRKSSLSKMSSDLQM
RSSQAHRNYLEDGFLRCLSVNSKWILTIILILAIILILSVMVLLWICCAAVATAVEQYIP
SEKLSIYGDLKFMNEQKLSRYPVSSPVVIRSKTEDHEEAGPLPTKMNLVHSEIKDFFFKE
NSHRHLNFHSS
Download sequence
Identical sequences G5BFI3
HGL_H00000360389-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]