SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360540 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000360540
Domain Number - Region: 280-387
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360540
Sequence length 453
Comment CEP55 (Homo_sapiens) centrosomal protein 55kDa
Sequence
MSSRSSKDLMKSKWGSKPSNTKSETALEKLKGAVDELTSGKGKLTEKDRHRLLEKIQVLQ
YEREKNVYHLTEKEKEIQRLRDQLKARYSTTALLEQLEEKTKEGDRMEQLLKSLSEETDS
LKKQLSAAMARLREFENQASTLHLSQAVAASSSMSNAHELEIQLKDALEKNQQWLVYDQQ
REVFVRGLLAKIFELEKKMETSAPSLPQQTEKAESEGDVQEEKQKYYSHLLANAKKDLEV
ERQTITQLSLELNEFRKKYEEAQKEVQDLNQLLCSQREAELQHLEDDRHKTERIERLKEE
NSIARGKLEEERKRSEELSSQVQFLYMSLLKQQGEETRVALLEQQMQSCTLDFENEKLGR
QDMQHQLHVILKELRKARSQITQLESLKQLHEFPFTEPLVTFQGETANKVKVASPRSPTA
ALNKSLVECPKCNAQYPATEHRDLLVHVEYCSE
Download sequence
Identical sequences G5BE81
XP_004838577.1.39548 XP_004838578.1.39548 HGL_H00000360540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]