SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360601 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360601
Domain Number 1 Region: 508-655,772-910
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.67e-55
Family Phosphate binding protein-like 0.000000000103
Further Details:      
 
Domain Number 2 Region: 244-503
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.09e-37
Family L-arabinose binding protein-like 0.0067
Further Details:      
 
Domain Number 3 Region: 662-767,801-829
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000157
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Weak hits

Sequence:  HGL_H00000360601
Domain Number - Region: 21-134
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000192
Family L-arabinose binding protein-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360601
Sequence length 1039
Comment GRIN1 (Homo_sapiens) glutamate receptor, ionotropic, N-methyl D-aspartate 1
Sequence
MSTMRLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSVHLSSLPPQSVHLSSLPPQSVHLSSLPPQSVHLSSLPPQSVHLSSLPP
QSVHLSSLPPQSVHLSSLPPQSVHLSSLPPQSVHLSSLPPQSVHLSSLPPQSVHLSSLPP
QSSIHLSFLRTVPPYSHQASVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEARELEARVIILSASEDDA
ATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDXVVAQAVHELLEKENITDPPRGCV
GNTNIWKTGPLFKRVLMSSKYSDGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
SHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEVTVNGD
PVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQER
VNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWF
SWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGIND
PRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLD
KTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQ
LAFAAVNVWRKNLQAVGLALAPVGRTGARNRGWGQQSEGERAGSFGDLATAPTGGHKATL
TIRLQGQCPGAASIAPVPS
Download sequence
Identical sequences G5BZF7
HGL_H00000360601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]