SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360642 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360642
Domain Number 1 Region: 699-838
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000116
Family Synaptotagmin-like (S variant) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360642
Sequence length 862
Comment CC2D1B (Homo_sapiens) coiled-coil and C2 domain containing 1B
Sequence
MPGPRPRKGPQASGQGVAAAKQLGLFVEFSTEDMMLGMDETEDDGDLEAELLALTGEAGT
TKEKPAPKGQAPLPMAHIEKLAADCMRDVEEEEEEEGLEEDADLLNELQEVLGTDEEAGP
LDSDEAASPDLCEEEKGQEDTEAPVPAALLTPSVPEAQVGSGGRPCVPLMLLLSMSNMHA
ARLAQQAEEAGEAAKARRCERGLKTLESQLAAVRKGRKVNEEEIPPPVALGKRPPASQET
ANRSSQADTPAPPALEPDNASHSESSLLGSPGIATLPDADPDPRALLLARQREYKVAALN
AKRAGELDRARELMRIGKRFGAVLEALEKGQPVDLSAMPPVPDDLKTPSQVAEAPEAPSV
PPPAVERVQPVMASDIPSAPVIPAEPQTVLDALQQRLNKYREAGTQARASGNERKARMHE
RIAKQYQDAIRAHQAGRKVDFAELPVPPGFPPIHGLEPTVGSEDSVAATLAAAQKLATSE
DTAPADEDEDEVWPRARDAGLAQAPVAKKPAQPLLPSSRPQPEPKASSSRESLSPTVREQ
LALLEARKLQYQRAALQAKRKQDLEQAKAHLRVAKGLEAQVIQARAGRPIDLSKVPSPLT
DEEGDFILIHHEDLRLSQKAEEVYAQLQKMLLEQYEKCLLFSKQFMHQGNVAETTRFEKL
AQDRKKQLEIMHLAQAQGLDPPSHHFELKTFQTVRIFSELNSTEMHLIIVRGMNLPAPPG
VTTDDLDAFVRFEFHYPNSDQAQKGKTAVVKNTNSPEFDQVFKLNINRNHRGFRRVIQSK
GIKFEIFHKGSFFRSDKLVGTAHLKLEQLENECEIREIVEVLDGRKPTGGKLEVKVRLRE
PLSGQDMQTVTENWLVLEPRGL
Download sequence
Identical sequences G5AUI3
HGL_H00000360642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]