SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360689 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360689
Domain Number 1 Region: 335-469,496-634
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-67
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 28-318
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.3e-66
Family Ankyrin repeat 0.0000254
Further Details:      
 
Domain Number 3 Region: 644-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.62e-40
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 953-1156
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 5 Region: 874-935
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000334
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360689
Sequence length 1166
Comment TNKS2 (Homo_sapiens) tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2
Sequence
MSGRRCAGGAAACASLVAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLQHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAESTIRNTDGRTALDLADPSAKAVLTGEYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRIKIVQLLLQHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSNG
ADPTLLNCHNKSAIDLAPTPQLKERLSYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAGSPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV
KHEAKVNALDNLGQTSLHRAAHCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQV
LQEGIPLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADSLSSGPSSPSSLSAASS
LDNLSGSFSELSSVVSSSGTEGASGLERKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNSAGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIVRPESTVDG
Download sequence
Identical sequences G5BV11
XP_004838560.1.39548 HGL_H00000360689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]