SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360762-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360762-1
Domain Number 1 Region: 126-306
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.88e-52
Family Ankyrin repeat 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360762-1
Sequence length 319
Comment ANKRD1 (Homo_sapiens) ankyrin repeat domain 1 (cardiac muscle)
Sequence
MMVLKVEDLVTGKKNSNGETREFLPEDFRDGEYEAAVTLEKQDDLKTLPGYHVSLAEQQW
KSEKQREAELKKKKLEQRSKLENLEDLEMIIQLKKRKKYRKTKVPVVKEPEPQIITEPVD
VPQFLKAALENKLPVVVKFLSDKDNPDVCDEYKRTALHRACLEGHLAIVEKLIEAGAQIE
FRDMLESTAIHWACRGGSLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIA
CEADLNSKDREGDTPLHDAVRLNRYKMVRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTK
AIFDSLKENSYKTSRIATF
Download sequence
Identical sequences G5B101
HGL_H00000360762-1 XP_004838549.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]