SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360806 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360806
Domain Number 1 Region: 2-222
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.03e-56
Family Voltage-gated potassium channels 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360806
Sequence length 663
Comment KCNB1 (Homo_sapiens) potassium voltage-gated channel, Shab-related subfamily, member 1
Sequence
MFIVLSTIALSLNTLPELQSLDEFGQNTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWK
FFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTG
LQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMT
TVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREAL
ERAKRNGSIVSMNMKDAFARSIEMMDVVVEKNGENMGKKDKVQDNHLSPNKWKWTKRTLS
ETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQSQPILTTKDSAPQSKP
KEELEMESIPSPIAPLPTRTEGVIDMRSMSSIDSFISCATDFPEATKFSHSPLASLPSKT
GGSTAPEVGWRGALGASGGRLVEANPTPDASHHSSFFIESPKSSMKTNNPLKLRALKVNF
MEGDPSPLLPVLGMYHDPLRNRGSAATAVTGLECATLLDKPVLSPESSIYTTATSARTPP
RSPEKHTAIAFNFEAGVHQYIDADTDDEGQLLYSVDSSPPKSIRGSTSPKYSLGTRSEKN
HFESSPLPTSPKYLKQNCIYSTEALTGKGPSGQEKCKLENHISPDVRVLPGRGAHGSTRD
QSI
Download sequence
Identical sequences G5B9N8
HGL_H00000360806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]