SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360826 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360826
Domain Number 1 Region: 6-157
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.68e-52
Family Ankyrin repeat 0.0000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360826
Sequence length 168
Comment CDKN2C (Homo_sapiens) cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPNLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLQVVE
FLLKHTASNVGHQNHKGDTAFDLARLYGRNEVLSLMEANGVGGATNLR
Download sequence
Identical sequences G5C4G1
XP_004869329.1.39548 HGL_H00000360826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]