SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360886 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360886
Domain Number 1 Region: 137-227,299-382
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.43e-45
Family Canonical RBD 0.0000263
Further Details:      
 
Domain Number 2 Region: 25-132
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-29
Family Canonical RBD 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360886
Sequence length 385
Comment ELAVL4 (Homo_sapiens) ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
Sequence
MEWNGLKMIISTMEPQVSNGPTSNTSNGPSTNNRNCPSPMQTGAATDDSKTNLIVNYLPQ
NMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTK
TIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGV
GFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPG
PLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAI
ASLNGYRLGDRVLQVSFKTNKAHKS
Download sequence
Identical sequences G5C4G5
HGL_H00000360886 XP_004869335.1.39548 XP_006147323.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]