SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360913 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000360913
Domain Number - Region: 18-69
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0425
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360913
Sequence length 294
Comment SPATA6 (Homo_sapiens) spermatogenesis associated 6
Sequence
MPKMKALQCALALEIRSLTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMV
FEKVFPEAVDPRDVVAQLELGETLSTYEENTRDFMFPGPNQISGHHDSNRQVTMRRISGL
RVDPPSSRAGTFFGPCGRDCERDEWSRTHNDHSHLGCYRPKDYKVIRTPHRRDSDDSLGR
CEEYLSPRSCSKPQHSARTLLVHSAPSTMPKHSPSPVLNRASLRERFHSDWCSPSNCDEI
HDRVKNVLKSHQAHPRHFYDERDPEKDDELELKRGVLYRDSAYDSDPENRYKHG
Download sequence
Identical sequences G5B6E0
HGL_H00000360913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]